PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028160m
Common NameCARUB_v10028160mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 234aa    MW: 26980.4 Da    PI: 10.2052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028160mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-1456103148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W + Ed +l + v+q+ g   W++Ia+ +  gRt+kqc++rw+++l
  Carubv10028160m  56 KGKWGKSEDMKLNQMVEQYDGIiKWASIAKNLK-GRTGKQCRERWHNHL 103
                      79******************87**********9.*************97 PP

2Myb_DNA-binding51.62.2e-16110151245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +WT+eEd++lv ++k  G++ W +I+++++ gRt++++k+rw+
  Carubv10028160m 110 TAWTKEEDQILVAVHKVVGTK-WYSISQHLP-GRTENNIKNRWN 151
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-842100IPR009057Homeodomain-like
PROSITE profilePS5129415.27351103IPR017930Myb domain
SMARTSM007175.2E-1355105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2557109IPR009057Homeodomain-like
CDDcd001676.96E-1258103No hitNo description
PfamPF139212.2E-1559118No hitNo description
SuperFamilySSF466891.63E-2883161IPR009057Homeodomain-like
PROSITE profilePS5129424.575104158IPR017930Myb domain
SMARTSM007171.4E-14108156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-21110156IPR009057Homeodomain-like
CDDcd001673.14E-10111154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGEPQSFDMP VPEDIKNTTS EIMNQGKGQK MVRTHQKKNK KIVQTSNHSK KSNIIKGKWG  60
KSEDMKLNQM VEQYDGIIKW ASIAKNLKGR TGKQCRERWH NHLRPGIKKT AWTKEEDQIL  120
VAVHKVVGTK WYSISQHLPG RTENNIKNRW NATKRRVQNQ SGENSNLADN NVLENYIRYI  180
TINNDNLSKT SEDVNLNMDV GTQTNEPLVN ASTTSYYVPM PENFTWENYA REF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-37531564106B-MYB
1gv2_A4e-37541562103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279527.11e-174hypothetical protein CARUB_v10028160mg
SwissprotQ9S7L23e-44MYB98_ARATH; Transcription factor MYB98
TrEMBLR0GJE81e-174R0GJE8_9BRAS; Uncharacterized protein
STRINGAT5G40430.13e-82(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133031427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40430.17e-86myb domain protein 22